Lineage for d2muta_ (2mut A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737577Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1737768Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 1737823Family a.60.2.5: Hef domain-like [140629] (4 proteins)
    helicase/nuclease domain; forms homo and heterodimers; probably includes the Excinuclease UvrC C-terminal domain ((81795), that contains a single NMR structure of a monomeric truncated domain, 1kft)
  6. 1737828Protein DNA excision repair protein ERCC-1 [140630] (1 species)
  7. 1737829Species Human (Homo sapiens) [TaxId:9606] [140631] (3 PDB entries)
    Uniprot P07992 219-296! Uniprot P07992 220-297
  8. 1737831Domain d2muta_: 2mut A: [274219]
    Other proteins in same PDB: d2mutb_
    automated match to d1z00a1
    mutant

Details for d2muta_

PDB Entry: 2mut (more details)

PDB Description: solution structure of the f231l mutant ercc1-xpf dimerization region
PDB Compounds: (A:) DNA excision repair protein ERCC-1

SCOPe Domain Sequences for d2muta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2muta_ a.60.2.5 (A:) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]}
rirrrynmadllmekleqdlvsrvteclttvksvnktdsqtllttfgsleqliaasredl
alcpglgpqkarrlfdvlhepflkvpgglehhhhhh

SCOPe Domain Coordinates for d2muta_:

Click to download the PDB-style file with coordinates for d2muta_.
(The format of our PDB-style files is described here.)

Timeline for d2muta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2mutb_