![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) ![]() duplication: contains two helix-hairpin-helix (HhH) motifs |
![]() | Family a.60.2.5: Hef domain-like [140629] (4 proteins) helicase/nuclease domain; forms homo and heterodimers; probably includes the Excinuclease UvrC C-terminal domain ((81795), that contains a single NMR structure of a monomeric truncated domain, 1kft) |
![]() | Protein DNA repair endonuclease XPF [140634] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140636] (4 PDB entries) Uniprot Q92889 823-905! Uniprot Q92889 837-898 |
![]() | Domain d2mutb_: 2mut B: [274222] Other proteins in same PDB: d2muta_ automated match to d2aq0a_ mutant |
PDB Entry: 2mut (more details)
SCOPe Domain Sequences for d2mutb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mutb_ a.60.2.5 (B:) DNA repair endonuclease XPF {Human (Homo sapiens) [TaxId: 9606]} mdsetlpesekynpgpqdfllkmpgvnakncrslmhhvkniaelaalsqdeltsilgnaa nakqlydfihtsfaevvskgkgkk
Timeline for d2mutb_: