Lineage for d1z00a1 (1z00 A:220-297)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2328799Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 2328855Family a.60.2.5: Hef domain-like [140629] (4 proteins)
    helicase/nuclease domain; forms homo and heterodimers; probably includes the Excinuclease UvrC C-terminal domain ((81795), that contains a single NMR structure of a monomeric truncated domain, 1kft)
  6. 2328860Protein DNA excision repair protein ERCC-1 [140630] (1 species)
  7. 2328861Species Human (Homo sapiens) [TaxId:9606] [140631] (3 PDB entries)
    Uniprot P07992 219-296! Uniprot P07992 220-297
  8. 2328864Domain d1z00a1: 1z00 A:220-297 [124294]
    Other proteins in same PDB: d1z00a2, d1z00b1

Details for d1z00a1

PDB Entry: 1z00 (more details)

PDB Description: solution structure of the c-terminal domain of ercc1 complexed with the c-terminal domain of xpf
PDB Compounds: (A:) DNA excision repair protein ERCC-1

SCOPe Domain Sequences for d1z00a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z00a1 a.60.2.5 (A:220-297) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]}
adllmekleqdfvsrvteclttvksvnktdsqtllttfgsleqliaasredlalcpglgp
qkarrlfdvlhepflkvp

SCOPe Domain Coordinates for d1z00a1:

Click to download the PDB-style file with coordinates for d1z00a1.
(The format of our PDB-style files is described here.)

Timeline for d1z00a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z00a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1z00b1