Lineage for d4kbqa_ (4kbq A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726989Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 2726990Protein automated matches [191037] (12 species)
    not a true protein
  7. 2727017Species Human (Homo sapiens) [TaxId:9606] [255451] (15 PDB entries)
  8. 2727031Domain d4kbqa_: 4kbq A: [268316]
    Other proteins in same PDB: d4kbqc1, d4kbqc2, d4kbqd1, d4kbqd2
    automated match to d2vyib_

Details for d4kbqa_

PDB Entry: 4kbq (more details), 2.91 Å

PDB Description: structure of the chip-tpr domain in complex with the hsc70 lid-tail domains
PDB Compounds: (A:) E3 ubiquitin-protein ligase CHIP

SCOPe Domain Sequences for d4kbqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kbqa_ a.118.8.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqqheqaladc
rraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddipsalriak
kkrwnsieer

SCOPe Domain Coordinates for d4kbqa_:

Click to download the PDB-style file with coordinates for d4kbqa_.
(The format of our PDB-style files is described here.)

Timeline for d4kbqa_: