SCOPe 2.08: Domain d4kbqc1: 4kbq C:541-618

Lineage for d4kbqc1 (4kbq C:541-618)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (2 families)

5. Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 proteins)

6. Protein automated matches [227118] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255449] (2 PDB entries)

8. Domain d4kbqc1: 4kbq C:541-618 [268303]
   Other proteins in same PDB: d4kbqa_, d4kbqb_, d4kbqc2, d4kbqd2
   automated match to d1ud0c_

Details for d4kbqc1

PDB Entry: 4kbq, 2.91 Å

PDB Description: structure of the chip-tpr domain in complex with the hsc70 lid-tail domains

PDB Compounds: (C:) Heat shock cognate 71 kDa protein

SCOPe Domain Sequences for d4kbqc1:

Sequence; same for both SEQRES and ATOM records:

>d4kbqc1 a.8.4.1 (C:541-618) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slesyafnmkatvedeklqgkindedkqkildkcneiinwldknqtaekeefehqqkele
kvcnpiitklyqsaggmp

Timeline for d4kbqc1:

• d4kbqc1 first appeared in SCOPe 2.05
  
• d4kbqc1 appears in SCOPe 2.07