![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
![]() | Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (2 families) ![]() |
![]() | Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 proteins) |
![]() | Protein automated matches [227118] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255449] (2 PDB entries) |
![]() | Domain d4kbqd1: 4kbq D:541-620 [268300] Other proteins in same PDB: d4kbqa_, d4kbqb_, d4kbqc2, d4kbqd2 automated match to d1ud0c_ |
PDB Entry: 4kbq (more details), 2.91 Å
SCOPe Domain Sequences for d4kbqd1:
Sequence, based on SEQRES records: (download)
>d4kbqd1 a.8.4.1 (D:541-620) automated matches {Human (Homo sapiens) [TaxId: 9606]} slesyafnmkatvedeklqgkindedkqkildkcneiinwldknqtaekeefehqqkele kvcnpiitklyqsaggmpgg
>d4kbqd1 a.8.4.1 (D:541-620) automated matches {Human (Homo sapiens) [TaxId: 9606]} slesyafnmkatvedekkindedkqkildkcneiinwldknqtaefehqqkelekvcnpi itklyqsaggmpgg
Timeline for d4kbqd1:
![]() Domains from other chains: (mouse over for more information) d4kbqa_, d4kbqb_, d4kbqc1, d4kbqc2 |