Lineage for d2vyib_ (2vyi B:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.8: TPR-like [48452] (11 families) 
Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
Protein automated matches [190103] (5 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [186825] (13 PDB entries) 
Domain d2vyib_: 2vyi B: [231362]
automated match to d2vyia1
Details for d2vyib_
PDB Entry: 2vyi (more details), 2.4 Å
PDB Description: crystal structure of the tpr domain of human sgt
PDB Compounds: (B:) sgta proteinSCOPe Domain Sequences for d2vyib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vyib_ a.118.8.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edsaeaerlktegneqmkvenfeaavhfygkaielnpanavyfcnraaaysklgnyagav
qdceraicidpayskaygrmglalsslnkhveavayykkaleldpdnetyksnlkiaelk
lrea
SCOPe Domain Coordinates for d2vyib_:
Click to download the PDB-style file with coordinates for d2vyib_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2vyib_:
- d2vyib_ first appeared in SCOPe 2.03
- d2vyib_ appears in SCOPe 2.07
View in 3D
