Lineage for d2g6vb1 (2g6v B:2-146)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918813Family c.97.1.0: automated matches [191471] (1 protein)
    not a true family
  6. 2918814Protein automated matches [190746] (16 species)
    not a true protein
  7. 2918824Species Escherichia coli [TaxId:562] [267777] (1 PDB entry)
  8. 2918826Domain d2g6vb1: 2g6v B:2-146 [264290]
    Other proteins in same PDB: d2g6va2, d2g6va3, d2g6vb2, d2g6vb3
    automated match to d2b3za2

Details for d2g6vb1

PDB Entry: 2g6v (more details), 2.6 Å

PDB Description: The crystal structure of ribD from Escherichia coli
PDB Compounds: (B:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d2g6vb1:

Sequence, based on SEQRES records: (download)

>d2g6vb1 c.97.1.0 (B:2-146) automated matches {Escherichia coli [TaxId: 562]}
qdeyymaralklaqrgrftthpnpnvgcvivkdgeivgegyhqragephaevhalrmage
kakgatayvtlepcshhgrtppccdaliaagvarvvasmqdpnpqvagrglyrlqqagid
vshglmmseaeqlnkgflkrmrtgf

Sequence, based on observed residues (ATOM records): (download)

>d2g6vb1 c.97.1.0 (B:2-146) automated matches {Escherichia coli [TaxId: 562]}
qdeyymaralklaqrgrftthpnpnvgcvivkdgeivgegyhqragephaevhalrmage
kakgatayvtlepcsdaliaagvarvvasmqdpnpqvagrglyrlqqagidvshglmmse
aeqlnkgflkrmrtgf

SCOPe Domain Coordinates for d2g6vb1:

Click to download the PDB-style file with coordinates for d2g6vb1.
(The format of our PDB-style files is described here.)

Timeline for d2g6vb1: