SCOPe 2.05: Domain d2g6vb1: 2g6v B:-4-146

Lineage for d2g6vb1 (2g6v B:-4-146)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.0: automated matches [191471] (1 protein)
   not a true family

6. Protein automated matches [190746] (11 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [267777] (1 PDB entry)

8. Domain d2g6vb1: 2g6v B:-4-146 [264290]
   Other proteins in same PDB: d2g6va2, d2g6vb2
   automated match to d2b3za2

Details for d2g6vb1

PDB Entry: 2g6v, 2.6 Å

PDB Description: The crystal structure of ribD from Escherichia coli

PDB Compounds: (B:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d2g6vb1:

Sequence, based on SEQRES records:

>d2g6vb1 c.97.1.0 (B:-4-146) automated matches {Escherichia coli [TaxId: 562]}
tlyiqgqdeyymaralklaqrgrftthpnpnvgcvivkdgeivgegyhqragephaevha
lrmagekakgatayvtlepcshhgrtppccdaliaagvarvvasmqdpnpqvagrglyrl
qqagidvshglmmseaeqlnkgflkrmrtgf

Sequence, based on observed residues (ATOM records):

>d2g6vb1 c.97.1.0 (B:-4-146) automated matches {Escherichia coli [TaxId: 562]}
tlyiqgqdeyymaralklaqrgrftthpnpnvgcvivkdgeivgegyhqragephaevha
lrmagekakgatayvtlepcsdaliaagvarvvasmqdpnpqvagrglyrlqqagidvsh
glmmseaeqlnkgflkrmrtgf

Timeline for d2g6vb1:

• d2g6vb1 is new in SCOPe 2.05-stable
  
• d2g6vb1 appears in SCOPe 2.06
  
• d2g6vb1 appears in the current release, SCOPe 2.08