SCOPe 2.08: Domain d2b3za2: 2b3z A:1-145

Lineage for d2b3za2 (2b3z A:1-145)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
contains extra C-terminal strand 5, order 21345
Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
strand 5 is parallel to strand 4
Protein Riboflavin biosynthesis protein RibD [142837] (2 species)
Species Bacillus subtilis [TaxId:1423] [142838] (4 PDB entries)
Uniprot P17618 1-145
Domain d2b3za2: 2b3z A:1-145 [127808]
Other proteins in same PDB: d2b3za1, d2b3zb1, d2b3zc1, d2b3zd1, d2b3zd3
complexed with zn

Details for d2b3za2

PDB Entry: 2b3z (more details), 2.41 Å

PDB Description: crystal structure of a bifunctional deaminase and reductase involved in riboflavin biosynthesis

PDB Compounds: (A:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d2b3za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b3za2 c.97.1.2 (A:1-145) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]}
meeyymklaldlakqgegqtesnplvgavvvkdgqivgmgahlkygeahaevhaihmaga
haegadiyvtlepcshygktppcaeliinsgikrvfvamrdpnplvagrgismmkeagie
vregiladqaerlnekflhfmrtgl

SCOPe Domain Coordinates for d2b3za2:

Click to download the PDB-style file with coordinates for d2b3za2.
(The format of our PDB-style files is described here.)

Timeline for d2b3za2: