![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
![]() | Protein automated matches [190777] (28 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [267778] (7 PDB entries) |
![]() | Domain d2g6va2: 2g6v A:147-367 [264289] Other proteins in same PDB: d2g6va1, d2g6va3, d2g6vb1, d2g6vb3 automated match to d2b3za1 |
PDB Entry: 2g6v (more details), 2.6 Å
SCOPe Domain Sequences for d2g6va2:
Sequence, based on SEQRES records: (download)
>d2g6va2 c.71.1.0 (A:147-367) automated matches {Escherichia coli [TaxId: 562]} pyiqlklgasldgrtamasgesqwitspqarrdvqllraqshailtssatvladdpaltv rwseldeqtqalypqqnlrqpirividsqnrvtpvhrivqqpgetwfartqedsrewpet vrtllipehkghldlvvlmmqlgkqqinsiwveagptlagallqaglvdelivyiapkll gsdarglctlpglekladapqfkfkeirhvgpdvclhlvga
>d2g6va2 c.71.1.0 (A:147-367) automated matches {Escherichia coli [TaxId: 562]} pyiqlklgasldgrtamesqwitspqarrdvqllraqshailtssatvladdpaltvrws eldeqtqalypqqnlrqpirividsqnrvtpvhrivqqpgetwfartqedsrewpetvrt llipehkghldlvvlmmqlgkqqinsiwveagptlagallqaglvdelivyiapkllgsd arglctlpgpqfkfkeirhvgpdvclhlvga
Timeline for d2g6va2: