Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
Protein automated matches [190777] (28 species) not a true protein |
Species Escherichia coli [TaxId:562] [267778] (7 PDB entries) |
Domain d2g6vb2: 2g6v B:147-367 [264291] Other proteins in same PDB: d2g6va1, d2g6va3, d2g6vb1, d2g6vb3 automated match to d2b3za1 |
PDB Entry: 2g6v (more details), 2.6 Å
SCOPe Domain Sequences for d2g6vb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g6vb2 c.71.1.0 (B:147-367) automated matches {Escherichia coli [TaxId: 562]} pyiqlklgasldgrtamasgesqwitspqarrdvqllraqshailtssatvladdpaltv rwseldeqtqalypqqnlrqpirividsqnrvtpvhrivqqpgetwfartqedsrewpet vrtllipehkghldlvvlmmqlgkqqinsiwveagptlagallqaglvdelivyiapkll gsdarglctlpglekladapqfkfkeirhvgpdvclhlvga
Timeline for d2g6vb2: