Lineage for d2g6vb2 (2g6v B:147-367)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904032Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2904033Protein automated matches [190777] (28 species)
    not a true protein
  7. 2904182Species Escherichia coli [TaxId:562] [267778] (7 PDB entries)
  8. 2904194Domain d2g6vb2: 2g6v B:147-367 [264291]
    Other proteins in same PDB: d2g6va1, d2g6va3, d2g6vb1, d2g6vb3
    automated match to d2b3za1

Details for d2g6vb2

PDB Entry: 2g6v (more details), 2.6 Å

PDB Description: The crystal structure of ribD from Escherichia coli
PDB Compounds: (B:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d2g6vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g6vb2 c.71.1.0 (B:147-367) automated matches {Escherichia coli [TaxId: 562]}
pyiqlklgasldgrtamasgesqwitspqarrdvqllraqshailtssatvladdpaltv
rwseldeqtqalypqqnlrqpirividsqnrvtpvhrivqqpgetwfartqedsrewpet
vrtllipehkghldlvvlmmqlgkqqinsiwveagptlagallqaglvdelivyiapkll
gsdarglctlpglekladapqfkfkeirhvgpdvclhlvga

SCOPe Domain Coordinates for d2g6vb2:

Click to download the PDB-style file with coordinates for d2g6vb2.
(The format of our PDB-style files is described here.)

Timeline for d2g6vb2: