Class a: All alpha proteins [46456] (290 folds) |
Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) |
Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
Protein automated matches [254493] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255068] (17 PDB entries) |
Domain d4n0fm2: 4n0f M:197-388 [253864] Other proteins in same PDB: d4n0fa1, d4n0fa2, d4n0fb_, d4n0fe1, d4n0fe2, d4n0ff_, d4n0fh1, d4n0fh2, d4n0fi_, d4n0fk1, d4n0fk2, d4n0fl_ automated match to d4l8ua2 |
PDB Entry: 4n0f (more details), 3.02 Å
SCOPe Domain Sequences for d4n0fm2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n0fm2 a.126.1.0 (M:197-388) automated matches {Human (Homo sapiens) [TaxId: 9606]} rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde fkplveepqnli
Timeline for d4n0fm2: