SCOPe 2.08: Domain d4n0fe1: 4n0f E:4-176

Lineage for d4n0fe1 (4n0f E:4-176)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (35 PDB entries)

8. Domain d4n0fe1: 4n0f E:4-176 [253848]
   Other proteins in same PDB: d4n0fa2, d4n0fb_, d4n0fd1, d4n0fd2, d4n0fd3, d4n0fe2, d4n0ff_, d4n0fg1, d4n0fg2, d4n0fg3, d4n0fh2, d4n0fi_, d4n0fj1, d4n0fj2, d4n0fj3, d4n0fk2, d4n0fl_, d4n0fm1, d4n0fm2, d4n0fm3
   automated match to d1exua2

Details for d4n0fe1

PDB Entry: 4n0f, 3.02 Å

PDB Description: Human FcRn complexed with human serum albumin

PDB Compounds: (E:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d4n0fe1:

Sequence; same for both SEQRES and ATOM records:

>d4n0fe1 d.19.1.1 (E:4-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hlsllyhltavsspapgtpafwvsgwlgpqqylsynslrgeaepcgawvwenqvswywek
ettdlrikeklfleafkalggkgpytlqgllgcelgpdntsvptakfalngeefmnfdlk
qgtwggdwpealaisqrwqqqdkaankeltfllfscphrlrehlergrgnlew

Timeline for d4n0fe1:

• d4n0fe1 first appeared in SCOPe 2.04
  
• d4n0fe1 appears in SCOPe 2.07