SCOPe 2.08: Domain d4n0fk2: 4n0f K:177-267

Lineage for d4n0fk2 (4n0f K:177-267)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4n0fk2: 4n0f K:177-267 [253861]
   Other proteins in same PDB: d4n0fa1, d4n0fb_, d4n0fd1, d4n0fd2, d4n0fd3, d4n0fe1, d4n0ff_, d4n0fg1, d4n0fg2, d4n0fg3, d4n0fh1, d4n0fi_, d4n0fj1, d4n0fj2, d4n0fj3, d4n0fk1, d4n0fl_, d4n0fm1, d4n0fm2, d4n0fm3
   automated match to d1exua1

Details for d4n0fk2

PDB Entry: 4n0f, 3.02 Å

PDB Description: Human FcRn complexed with human serum albumin

PDB Compounds: (K:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d4n0fk2:

Sequence; same for both SEQRES and ATOM records:

>d4n0fk2 b.1.1.0 (K:177-267) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keppsmrlkarpsspgfsvltcsafsfyppelqlrflrnglaagtgqgdfgpnsdgsfha
sssltvksgdehhyccivqhaglaqplrvel

Timeline for d4n0fk2:

• d4n0fk2 first appeared in SCOPe 2.04
  
• d4n0fk2 appears in SCOPe 2.07