![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
![]() | Superfamily a.126.1: Serum albumin-like [48552] (2 families) ![]() |
![]() | Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
![]() | Protein automated matches [254493] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255068] (17 PDB entries) |
![]() | Domain d4n0fg3: 4n0f G:389-585 [253853] Other proteins in same PDB: d4n0fa1, d4n0fa2, d4n0fb_, d4n0fe1, d4n0fe2, d4n0ff_, d4n0fh1, d4n0fh2, d4n0fi_, d4n0fk1, d4n0fk2, d4n0fl_ automated match to d4emxa3 |
PDB Entry: 4n0f (more details), 3.02 Å
SCOPe Domain Sequences for d4n0fg3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n0fg3 a.126.1.0 (G:389-585) automated matches {Human (Homo sapiens) [TaxId: 9606]} kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf aeegkklvaasqaalgl
Timeline for d4n0fg3: