Lineage for d4n0fg3 (4n0f G:389-585)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2730252Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2730253Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2730697Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2730698Protein automated matches [254493] (6 species)
    not a true protein
  7. 2730831Species Human (Homo sapiens) [TaxId:9606] [255068] (17 PDB entries)
  8. 2730883Domain d4n0fg3: 4n0f G:389-585 [253853]
    Other proteins in same PDB: d4n0fa1, d4n0fa2, d4n0fb_, d4n0fe1, d4n0fe2, d4n0ff_, d4n0fh1, d4n0fh2, d4n0fi_, d4n0fk1, d4n0fk2, d4n0fl_
    automated match to d4emxa3

Details for d4n0fg3

PDB Entry: 4n0f (more details), 3.02 Å

PDB Description: Human FcRn complexed with human serum albumin
PDB Compounds: (G:) serum albumin

SCOPe Domain Sequences for d4n0fg3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n0fg3 a.126.1.0 (G:389-585) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaalgl

SCOPe Domain Coordinates for d4n0fg3:

Click to download the PDB-style file with coordinates for d4n0fg3.
(The format of our PDB-style files is described here.)

Timeline for d4n0fg3: