Lineage for d4n0fe2 (4n0f E:177-267)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758896Domain d4n0fe2: 4n0f E:177-267 [253849]
    Other proteins in same PDB: d4n0fa1, d4n0fb_, d4n0fd1, d4n0fd2, d4n0fd3, d4n0fe1, d4n0ff_, d4n0fg1, d4n0fg2, d4n0fg3, d4n0fh1, d4n0fi_, d4n0fj1, d4n0fj2, d4n0fj3, d4n0fk1, d4n0fl_, d4n0fm1, d4n0fm2, d4n0fm3
    automated match to d1exua1

Details for d4n0fe2

PDB Entry: 4n0f (more details), 3.02 Å

PDB Description: Human FcRn complexed with human serum albumin
PDB Compounds: (E:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d4n0fe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n0fe2 b.1.1.0 (E:177-267) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keppsmrlkarpsspgfsvltcsafsfyppelqlrflrnglaagtgqgdfgpnsdgsfha
sssltvksgdehhyccivqhaglaqplrvel

SCOPe Domain Coordinates for d4n0fe2:

Click to download the PDB-style file with coordinates for d4n0fe2.
(The format of our PDB-style files is described here.)

Timeline for d4n0fe2: