Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d4n0fe2: 4n0f E:177-267 [253849] Other proteins in same PDB: d4n0fa1, d4n0fb_, d4n0fd1, d4n0fd2, d4n0fd3, d4n0fe1, d4n0ff_, d4n0fg1, d4n0fg2, d4n0fg3, d4n0fh1, d4n0fi_, d4n0fj1, d4n0fj2, d4n0fj3, d4n0fk1, d4n0fl_, d4n0fm1, d4n0fm2, d4n0fm3 automated match to d1exua1 |
PDB Entry: 4n0f (more details), 3.02 Å
SCOPe Domain Sequences for d4n0fe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n0fe2 b.1.1.0 (E:177-267) automated matches {Human (Homo sapiens) [TaxId: 9606]} keppsmrlkarpsspgfsvltcsafsfyppelqlrflrnglaagtgqgdfgpnsdgsfha sssltvksgdehhyccivqhaglaqplrvel
Timeline for d4n0fe2: