| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
| Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
| Protein automated matches [190220] (14 species) not a true protein |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [256268] (1 PDB entry) |
| Domain d4gaaa3: 4gaa A:458-607 [252169] Other proteins in same PDB: d4gaaa1, d4gaaa2, d4gaab1, d4gaab2 automated match to d3fh8a3 complexed with bes, zn |
PDB Entry: 4gaa (more details), 2.26 Å
SCOPe Domain Sequences for d4gaaa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gaaa3 a.118.1.0 (A:458-607) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dmtlanacitlgqkwvkatesdlgsfsaddvkdlsshqlievlailllekplpvshvkrm
qevynlndvknseirfrwlrlciragwedviplalamateqgrmkftrplyrdlynfeka
reqtvntflknrsfmhpvtemlvakdlhis
Timeline for d4gaaa3: