PDB entry 4gaa

View 4gaa on RCSB PDB site
Description: Structure of Leukotriene A4 hydrolase from Xenopus laevis complexed with inhibitor bestatin
Class: hydrolase/hydrolase inhibitor
Keywords: Leukotriene A4 hydrolase, Metalloprotein, Hydrolase, protease, Zinc binding, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-07-25, released 2013-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.223
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MGC78867 protein
    Species: Xenopus laevis [TaxId:8355]
    Gene: lta4h, MGC78867
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gaaa1, d4gaaa2, d4gaaa3
  • Chain 'B':
    Compound: MGC78867 protein
    Species: Xenopus laevis [TaxId:8355]
    Gene: lta4h, MGC78867
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gaab1, d4gaab2, d4gaab3
  • Heterogens: ZN, BES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gaaA (A:)
    madpssfaspekfnikhmhlklhvdftsraiaastsltvrslqdslaslildtkdltikk
    vavngkdatfalgtthsfkgtpleitlpfsltrgqeviveidsvtspkssalqwlnkeqt
    agkihpylfsqcqathcrsiipcqdtpsvkftyysqvsvpkelmalmsalrdgelseqsd
    snrkiyrfkqnvpipsylialvvgalegrkvgprttiwtekellepsvyefaetekmlky
    aedlagpyvwgqydllilppsfpyggmenpcltfvtptvlagdrslasviaheishswtg
    nlvtnetwenfwlneghtvylerridgrlygeefrqfkalggwkelqnsvntfgatnplt
    nlvpnlhevdvdaafssvpyekgfallfyleqllggpeiflgflksyiqmfafksvttee
    wkkflysyfkdkvdildkvdwkgwmhtpgmppvqpkydmtlanacitlgqkwvkatesdl
    gsfsaddvkdlsshqlievlailllekplpvshvkrmqevynlndvknseirfrwlrlci
    ragwedviplalamateqgrmkftrplyrdlynfekareqtvntflknrsfmhpvtemlv
    akdlhisas
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gaaA (A:)
    adpssfaspekfnikhmhlklhvdftsraiaastsltvrslqdslaslildtkdltikkv
    avngkdatfalgtthsfkgtpleitlpfsltrgqeviveidsvtspkssalqwlnkeqta
    gkihpylfsqcqathcrsiipcqdtpsvkftyysqvsvpkelmalmsalrdgelseqsds
    nrkiyrfkqnvpipsylialvvgalegrkvgprttiwtekellepsvyefaetekmlkya
    edlagpyvwgqydllilppsfpyggmenpcltfvtptvlagdrslasviaheishswtgn
    lvtnetwenfwlneghtvylerridgrlygeefrqfkalggwkelqnsvntfgatnpltn
    lvpnlhevdvdaafssvpyekgfallfyleqllggpeiflgflksyiqmfafksvtteew
    kkflysyfkdkvdildkvdwkgwmhtpgmppvqpkydmtlanacitlgqkwvkatesdlg
    sfsaddvkdlsshqlievlailllekplpvshvkrmqevynlndvknseirfrwlrlcir
    agwedviplalamateqgrmkftrplyrdlynfekareqtvntflknrsfmhpvtemlva
    kdlhis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gaaB (B:)
    madpssfaspekfnikhmhlklhvdftsraiaastsltvrslqdslaslildtkdltikk
    vavngkdatfalgtthsfkgtpleitlpfsltrgqeviveidsvtspkssalqwlnkeqt
    agkihpylfsqcqathcrsiipcqdtpsvkftyysqvsvpkelmalmsalrdgelseqsd
    snrkiyrfkqnvpipsylialvvgalegrkvgprttiwtekellepsvyefaetekmlky
    aedlagpyvwgqydllilppsfpyggmenpcltfvtptvlagdrslasviaheishswtg
    nlvtnetwenfwlneghtvylerridgrlygeefrqfkalggwkelqnsvntfgatnplt
    nlvpnlhevdvdaafssvpyekgfallfyleqllggpeiflgflksyiqmfafksvttee
    wkkflysyfkdkvdildkvdwkgwmhtpgmppvqpkydmtlanacitlgqkwvkatesdl
    gsfsaddvkdlsshqlievlailllekplpvshvkrmqevynlndvknseirfrwlrlci
    ragwedviplalamateqgrmkftrplyrdlynfekareqtvntflknrsfmhpvtemlv
    akdlhisas
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gaaB (B:)
    adpssfaspekfnikhmhlklhvdftsraiaastsltvrslqdslaslildtkdltikkv
    avngkdatfalgtthsfkgtpleitlpfsltrgqeviveidsvtspkssalqwlnkeqta
    gkihpylfsqcqathcrsiipcqdtpsvkftyysqvsvpkelmalmsalrdgelseqsds
    nrkiyrfkqnvpipsylialvvgalegrkvgprttiwtekellepsvyefaetekmlkya
    edlagpyvwgqydllilppsfpyggmenpcltfvtptvlagdrslasviaheishswtgn
    lvtnetwenfwlneghtvylerridgrlygeefrqfkalggwkelqnsvntfgatnpltn
    lvpnlhevdvdaafssvpyekgfallfyleqllggpeiflgflksyiqmfafksvtteew
    kkflysyfkdkvdildkvdwkgwmhtpgmppvqpkydmtlanacitlgqkwvkatesdlg
    sfsaddvkdlsshqlievlailllekplpvshvkrmqevynlndvknseirfrwlrlcir
    agwedviplalamateqgrmkftrplyrdlynfekareqtvntflknrsfmhpvtemlva
    kdlhi