Lineage for d4gaab2 (4gaa B:206-457)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530181Species African clawed frog (Xenopus laevis) [TaxId:8355] [256267] (1 PDB entry)
  8. 2530183Domain d4gaab2: 4gaa B:206-457 [252171]
    Other proteins in same PDB: d4gaaa1, d4gaaa3, d4gaab1, d4gaab3
    automated match to d3funa2
    complexed with bes, zn

Details for d4gaab2

PDB Entry: 4gaa (more details), 2.26 Å

PDB Description: Structure of Leukotriene A4 hydrolase from Xenopus laevis complexed with inhibitor bestatin
PDB Compounds: (B:) MGC78867 protein

SCOPe Domain Sequences for d4gaab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gaab2 d.92.1.0 (B:206-457) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
legrkvgprttiwtekellepsvyefaetekmlkyaedlagpyvwgqydllilppsfpyg
gmenpcltfvtptvlagdrslasviaheishswtgnlvtnetwenfwlneghtvylerri
dgrlygeefrqfkalggwkelqnsvntfgatnpltnlvpnlhevdvdaafssvpyekgfa
llfyleqllggpeiflgflksyiqmfafksvtteewkkflysyfkdkvdildkvdwkgwm
htpgmppvqpky

SCOPe Domain Coordinates for d4gaab2:

Click to download the PDB-style file with coordinates for d4gaab2.
(The format of our PDB-style files is described here.)

Timeline for d4gaab2: