SCOPe 2.08: Domain d4gaaa2: 4gaa A:206-457

Lineage for d4gaaa2 (4gaa A:206-457)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.0: automated matches [191495] (1 protein)
   not a true family

6. Protein automated matches [190805] (20 species)
   not a true protein

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [256267] (1 PDB entry)

8. Domain d4gaaa2: 4gaa A:206-457 [252168]
   Other proteins in same PDB: d4gaaa1, d4gaaa3, d4gaab1, d4gaab3
   automated match to d3funa2
   complexed with bes, zn

Details for d4gaaa2

PDB Entry: 4gaa, 2.26 Å

PDB Description: Structure of Leukotriene A4 hydrolase from Xenopus laevis complexed with inhibitor bestatin

PDB Compounds: (A:) MGC78867 protein

SCOPe Domain Sequences for d4gaaa2:

Sequence; same for both SEQRES and ATOM records:

>d4gaaa2 d.92.1.0 (A:206-457) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
legrkvgprttiwtekellepsvyefaetekmlkyaedlagpyvwgqydllilppsfpyg
gmenpcltfvtptvlagdrslasviaheishswtgnlvtnetwenfwlneghtvylerri
dgrlygeefrqfkalggwkelqnsvntfgatnpltnlvpnlhevdvdaafssvpyekgfa
llfyleqllggpeiflgflksyiqmfafksvtteewkkflysyfkdkvdildkvdwkgwm
htpgmppvqpky

Timeline for d4gaaa2:

• d4gaaa2 first appeared in SCOPe 2.04
  
• d4gaaa2 appears in SCOPe 2.07