Lineage for d3u7ua2 (3u7u A:159-311)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030968Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 3031041Family g.3.9.0: automated matches [232406] (1 protein)
    not a true family
  6. 3031042Protein automated matches [232407] (3 species)
    not a true protein
  7. 3031043Species Human (Homo sapiens) [TaxId:9606] [232408] (18 PDB entries)
  8. 3031076Domain d3u7ua2: 3u7u A:159-311 [250146]
    Other proteins in same PDB: d3u7ua1, d3u7ua3
    automated match to d1n8zc3
    complexed with nag

Details for d3u7ua2

PDB Entry: 3u7u (more details), 3.03 Å

PDB Description: crystal structure of extracellular region of human epidermal growth factor receptor 4 in complex with neuregulin-1 beta
PDB Compounds: (A:) Receptor tyrosine-protein kinase erbB-4

SCOPe Domain Sequences for d3u7ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u7ua2 g.3.9.0 (A:159-311) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgcgrchksctgrcwgptenhcqtltrtvcaeqcdgrcygpyvsdcchrecaggcsgpkd
tdcfacmnfndsgacvtqcpqtfvynpttfqlehnfnakytygafcvkkcphnfvvdsss
cvracpsskmeveengikmckpctdicpkacdg

SCOPe Domain Coordinates for d3u7ua2:

Click to download the PDB-style file with coordinates for d3u7ua2.
(The format of our PDB-style files is described here.)

Timeline for d3u7ua2: