PDB entry 3u7u

View 3u7u on RCSB PDB site
Description: Crystal structure of extracellular region of human epidermal growth factor receptor 4 in complex with neuregulin-1 beta
Class: transferase/transferase regulator
Keywords: signaling protein, TRANSFERASE-TRANSFERASE REGULATOR COMPLEX, Glycosylation
Deposited on 2011-10-14, released 2012-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 3.03 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor tyrosine-protein kinase erbB-4
    Species: Homo sapiens [TaxId:9606]
    Gene: ERBB4, HER4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15303 (0-End)
      • conflict (523)
    Domains in SCOPe 2.07: d3u7ua1, d3u7ua2, d3u7ua3
  • Chain 'B':
    Compound: Receptor tyrosine-protein kinase erbB-4
    Species: Homo sapiens [TaxId:9606]
    Gene: ERBB4, HER4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15303 (0-End)
      • conflict (523)
  • Chain 'C':
    Compound: Receptor tyrosine-protein kinase erbB-4
    Species: Homo sapiens [TaxId:9606]
    Gene: ERBB4, HER4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15303 (0-End)
      • conflict (523)
  • Chain 'D':
    Compound: Receptor tyrosine-protein kinase erbB-4
    Species: Homo sapiens [TaxId:9606]
    Gene: ERBB4, HER4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15303 (0-End)
      • conflict (523)
  • Chain 'E':
    Compound: Receptor tyrosine-protein kinase erbB-4
    Species: Homo sapiens [TaxId:9606]
    Gene: ERBB4, HER4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15303 (0-End)
      • conflict (523)
  • Chain 'F':
    Compound: Receptor tyrosine-protein kinase erbB-4
    Species: Homo sapiens [TaxId:9606]
    Gene: ERBB4, HER4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15303 (0-End)
      • conflict (523)
  • Chain 'G':
    Compound: Neuregulin 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NRG1
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Neuregulin 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NRG1
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Neuregulin 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NRG1
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Neuregulin 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NRG1
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Neuregulin 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NRG1
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Neuregulin 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NRG1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u7uA (A:)
    qsvcagtenklsslsdleqqyralrkyyencevvmgnleitsiehnrdlsflrsvrevtg
    yvlvalnqfrylplenlriirgtklyedryalaiflnyrkdgnfglqelglknlteilng
    gvyvdqnkflcyadtihwqdivrnpwpsnltlvstngssgcgrchksctgrcwgptenhc
    qtltrtvcaeqcdgrcygpyvsdcchrecaggcsgpkdtdcfacmnfndsgacvtqcpqt
    fvynpttfqlehnfnakytygafcvkkcphnfvvdssscvracpsskmeveengikmckp
    ctdicpkacdgigtgslmsaqtvdssnidkfinctkingnliflvtgihgdpynaieaid
    peklnvfrtvreitgflniqswppnmtdfsvfsnlvtiggrvlysglsllilkqqgitsl
    qfqslkeisagniyitdnsnlcyyhtinwttlfstinqrivirdnrkaenctaegmvcnh
    lcssdgcwgpgpdqclscrrfsrgriciescnlydgefrefendsicvecdpqcekmedg
    lltchgpgpdnctkcshfkdgpncvekcpdglqgansfifkyadpdrechpchpnctqgc
    ngptshdciyypwtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u7uA (A:)
    qsvcagtenklsslsdleqqyralrkyyencevvmgnleitsiehnrdlsflrsvrevtg
    yvlvalnqfrylplenlriirgtklyedryalaiflnyrkdgnfglqelglknlteilng
    gvyvdqnkflcyadtihwqdivrnpsnltlvssgcgrchksctgrcwgptenhcqtltrt
    vcaeqcdgrcygpyvsdcchrecaggcsgpkdtdcfacmnfndsgacvtqcpqtfvynpt
    tfqlehnfnakytygafcvkkcphnfvvdssscvracpsskmeveengikmckpctdicp
    kacdgigtgslmsaqtvdssnidkfinctkingnliflvtgihgdpynaieaidpeklnv
    frtvreitgflniqswppnmtdfsvfsnlvtiggrvlysglsllilkqqgitslqfqslk
    eisagniyitdnsnlcyyhtinwttlfstinqrivirdnrkaenctaegmvcnhlcssdg
    cwgpgpdqclscrrfsrgriciescnlydgefrefendsicvecdpqcekmedglltchg
    pgpdnctkcs
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.