SCOPe 2.04: Domain d3u7ua2: 3u7u A:159-311

Lineage for d3u7ua2 (3u7u A:159-311)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.9: Growth factor receptor domain [57184] (2 families)

5. Family g.3.9.0: automated matches [232406] (1 protein)
   not a true family

6. Protein automated matches [232407] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [232408] (7 PDB entries)

8. Domain d3u7ua2: 3u7u A:159-311 [250146]
   Other proteins in same PDB: d3u7ua1, d3u7ua3
   automated match to d1n8zc3
   complexed with nag

Details for d3u7ua2

PDB Entry: 3u7u, 3.03 Å

PDB Description: crystal structure of extracellular region of human epidermal growth factor receptor 4 in complex with neuregulin-1 beta

PDB Compounds: (A:) Receptor tyrosine-protein kinase erbB-4

SCOPe Domain Sequences for d3u7ua2:

Sequence; same for both SEQRES and ATOM records:

>d3u7ua2 g.3.9.0 (A:159-311) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgcgrchksctgrcwgptenhcqtltrtvcaeqcdgrcygpyvsdcchrecaggcsgpkd
tdcfacmnfndsgacvtqcpqtfvynpttfqlehnfnakytygafcvkkcphnfvvdsss
cvracpsskmeveengikmckpctdicpkacdg

Timeline for d3u7ua2:

• d3u7ua2 is new in SCOPe 2.04-stable
  
• d3u7ua2 appears in SCOPe 2.05
  
• d3u7ua2 appears in the current release, SCOPe 2.07