Lineage for d3puya1 (3puy A:2-235)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870122Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
    missing some secondary structures that made up less than one-third of the common domain
  6. 2870265Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species)
  7. 2870266Species Escherichia coli [TaxId:562] [102380] (15 PDB entries)
  8. 2870297Domain d3puya1: 3puy A:2-235 [248658]
    Other proteins in same PDB: d3puya2, d3puya3, d3puyb2, d3puye1, d3puye2, d3puyf1, d3puyf2, d3puyg_
    automated match to d3rlfa1
    complexed with anp, mg, pgv

Details for d3puya1

PDB Entry: 3puy (more details), 3.1 Å

PDB Description: crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state
PDB Compounds: (A:) Fused maltose transport subunit, ATP-binding component of ABC superfamily; regulatory protein

SCOPe Domain Sequences for d3puya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3puya1 c.37.1.12 (A:2-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}
asvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlf
igekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevl
qlahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhk
rlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfig

SCOPe Domain Coordinates for d3puya1:

Click to download the PDB-style file with coordinates for d3puya1.
(The format of our PDB-style files is described here.)

Timeline for d3puya1: