Lineage for d3puya2 (3puy A:236-371)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790988Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 2791072Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
    probably stems out from the biMOP domain
  6. 2791092Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)
  7. 2791093Species Escherichia coli [TaxId:562] [101772] (15 PDB entries)
  8. 2791124Domain d3puya2: 3puy A:236-371 [248659]
    Other proteins in same PDB: d3puya1, d3puya3, d3puyb1, d3puye1, d3puye2, d3puyf1, d3puyf2, d3puyg_
    automated match to d3puza2
    complexed with anp, mg, pgv

Details for d3puya2

PDB Entry: 3puy (more details), 3.1 Å

PDB Description: crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state
PDB Compounds: (A:) Fused maltose transport subunit, ATP-binding component of ABC superfamily; regulatory protein

SCOPe Domain Sequences for d3puya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3puya2 b.40.6.3 (A:236-371) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepgv

SCOPe Domain Coordinates for d3puya2:

Click to download the PDB-style file with coordinates for d3puya2.
(The format of our PDB-style files is described here.)

Timeline for d3puya2: