Lineage for d3puyg_ (3puy G:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2581051Fold f.58: MetI-like [161097] (1 superfamily)
    core: 5 transmembrane helices; flattened bundle
  4. 2581052Superfamily f.58.1: MetI-like [161098] (1 family) (S)
  5. 2581053Family f.58.1.1: MetI-like [161099] (6 protein domains)
    Pfam PF00528; Binding-protein-dependent transport system inner membrane component
  6. 2581087Protein automated matches [191243] (1 species)
    not a true protein
  7. 2581088Species Escherichia coli K-12 [TaxId:83333] [189709] (8 PDB entries)
  8. 2581093Domain d3puyg_: 3puy G: [248665]
    Other proteins in same PDB: d3puya1, d3puya2, d3puya3, d3puyb1, d3puyb2, d3puye1, d3puye2, d3puyf1, d3puyf2
    automated match to d3puxg_
    complexed with anp, mal, mg, pgv

Details for d3puyg_

PDB Entry: 3puy (more details), 3.1 Å

PDB Description: Crystal Structure of an outward-facing MBP-Maltose transporter complex bound to AMP-PNP after crystal soaking of the pretranslocation state
PDB Compounds: (G:) Maltose transporter subunit; membrane component of ABC superfamily

SCOPe Domain Sequences for d3puyg_:

Sequence, based on SEQRES records: (download)

>d3puyg_ f.58.1.1 (G:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
amvqpksqkarlfithlllllfiaaimfpllmvvaislrqgnfatgslipeqiswdhwkl
algfsveqadgritpppfpvllwlwnsvkvagisaigivalsttcayafarmrfpgkatl
lkgmlifqmfpavlslvalyalfdrlgeyipfiglnthggvifaylggialhvwtikgyf
etidssleeaaaldgatpwqafrlvllplsvpilavvfilsfiaaitevpvaslllrdvn
sytlavgmqqylnpqnylwgdfaaaavmsalpitivfllaqrwlvngltaggvkg

Sequence, based on observed residues (ATOM records): (download)

>d3puyg_ f.58.1.1 (G:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
amvqpqkarlfithlllllfiaaimfpllmvvaislrqgnfatgslipeqiswdhwklal
gfsveqadgritpppfpvllwlwnsvkvagisaigivalsttcayafarmrfpgkatllk
gmlifqmfpavlslvalyalfdrlgeyipfiglnthggvifaylggialhvwtikgyfet
idssleeaaaldgatpwqafrlvllplsvpilavvfilsfiaaitevpvaslllrdvnsy
tlavgmqqylnpqnylwgdfaaaavmsalpitivfllaqrwlvngltaggvkg

SCOPe Domain Coordinates for d3puyg_:

Click to download the PDB-style file with coordinates for d3puyg_.
(The format of our PDB-style files is described here.)

Timeline for d3puyg_: