Lineage for d3puyf2 (3puy F:261-503)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3029031Fold f.58: MetI-like [161097] (1 superfamily)
    core: 5 transmembrane helices; flattened bundle
  4. 3029032Superfamily f.58.1: MetI-like [161098] (1 family) (S)
  5. 3029033Family f.58.1.1: MetI-like [161099] (6 proteins)
    Pfam PF00528; Binding-protein-dependent transport system inner membrane component
  6. 3029043Protein Maltose transport system permease protein MalF [161106] (1 species)
  7. 3029044Species Escherichia coli [TaxId:562] [161107] (10 PDB entries)
    Uniprot P02916 261-504
  8. 3029053Domain d3puyf2: 3puy F:261-503 [248664]
    Other proteins in same PDB: d3puya1, d3puya2, d3puya3, d3puyb1, d3puyb2, d3puye1, d3puye2, d3puyf1, d3puyg_
    automated match to d2r6gf2
    complexed with anp, mg, pgv

Details for d3puyf2

PDB Entry: 3puy (more details), 3.1 Å

PDB Description: crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state
PDB Compounds: (F:) Maltose transporter subunit; membrane component of ABC superfamily

SCOPe Domain Sequences for d3puyf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3puyf2 f.58.1.1 (F:261-503) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]}
wknftrvftdegiqkpflaifvwtvvfslitvfltvavgmvlaclvqwealrgkavyrvl
lilpyavpsfisilifkglfnqsfgeinmmlsalfgvkpawfsdpttartmliivntwlg
ypymmilcmgllkaipddlyeasamdgagpfqnffkitlpllikpltplmiasfafnfnn
fvliqlltnggpdrlgtttpagytdllvnytyriafeggggqdfglaaaiatlifllvga
lai

SCOPe Domain Coordinates for d3puyf2:

Click to download the PDB-style file with coordinates for d3puyf2.
(The format of our PDB-style files is described here.)

Timeline for d3puyf2: