PDB entry 3puy

View 3puy on RCSB PDB site
Description: Crystal Structure of an outward-facing MBP-Maltose transporter complex bound to AMP-PNP after crystal soaking of the pretranslocation state
Class: transport protein, membrane protein
Keywords: ATP Binding Cassette, Nucleotide Binding Domain, Substrate Binding Protein, ABC Transporter, importer, ATPase, ATP binding, Maltodextrin binding, transmembrane integral membrane, TRANSPORT PROTEIN, MEMBRANE PROTEIN
Deposited on 2010-12-06, released 2011-05-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-06-22, with a file datestamp of 2011-06-17.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.216
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fused maltose transport subunit, ATP-binding component of ABC superfamily; regulatory protein
    Species: Escherichia coli [TaxId:83333]
    Gene: ECDH10B_4224, malK
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1XC34 (Start-370)
      • expression tag (371)
    Domains in SCOPe 2.06: d3puya1, d3puya2, d3puya3
  • Chain 'B':
    Compound: Fused maltose transport subunit, ATP-binding component of ABC superfamily; regulatory protein
    Species: Escherichia coli [TaxId:83333]
    Gene: ECDH10B_4224, malK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3puyb1, d3puyb2
  • Chain 'E':
    Compound: Maltose transporter subunit; periplasmic-binding component of ABC superfamily
    Species: Escherichia coli [TaxId:83333]
    Gene: ECDH10B_4223, malE
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1XC33 (0-369)
      • expression tag (370-373)
    Domains in SCOPe 2.06: d3puye1, d3puye2
  • Chain 'F':
    Compound: Maltose transporter subunit; membrane component of ABC superfamily
    Species: Escherichia coli [TaxId:83333]
    Gene: ECDH10B_4222, malF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3puyf1, d3puyf2
  • Chain 'G':
    Compound: Maltose transporter subunit; membrane component of ABC superfamily
    Species: Escherichia coli [TaxId:83333]
    Gene: ECDH10B_4221, malG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3puyg_
  • Heterogens: MAL, PGV, MG, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3puyA (A:)
    masvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdl
    figekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaev
    lqlahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlh
    krlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfigspkmn
    flpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdiadvil
    egevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlfredgt
    acrrlhkepgvasashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3puyA (A:)
    asvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlf
    igekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevl
    qlahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhk
    rlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfigspkmnf
    lpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdiadvile
    gevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlfredgta
    crrlhkepgva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3puyB (B:)
    masvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdl
    figekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaev
    lqlahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlh
    krlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfigspkmn
    flpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdiadvil
    egevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlfredgt
    acrrlhkepgvasashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3puyB (B:)
    asvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlf
    igekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevl
    qlahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhk
    rlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfigspkmnf
    lpvkataidqvqvelpmpnrqqvwlpvenmslgirpehllpsdiadvilegevqvveqlg
    netqihiqipsirqnlvyrqndvvlveegatfaiglpperchlfredgtacrrlhkep
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3puyE (E:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
    lkdaqtritkasashhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3puyE (E:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
    lkdaqtritkasas
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3puyF (F:)
    mdvikkkhwwqsdalkwsvlgllgllvgylvvlmyaqgeylfaittlilssaglyifanr
    kayawryvypgmagmglfvlfplvctiaiaftnysstnqltferaqevlldrswqagkty
    nfglypagdewqlalsdgetgknylsdafkfggeqklqlkettaqpegeranlrvitqnr
    qalsditailpdgnkvmmsslrqfsgtqplytldgdgtltnnqsgvkyrpnnqigfyqsi
    tadgnwgdeklspgytvttgwknftrvftdegiqkpflaifvwtvvfslitvfltvavgm
    vlaclvqwealrgkavyrvllilpyavpsfisilifkglfnqsfgeinmmlsalfgvkpa
    wfsdpttartmliivntwlgypymmilcmgllkaipddlyeasamdgagpfqnffkitlp
    llikpltplmiasfafnfnnfvliqlltnggpdrlgtttpagytdllvnytyriafeggg
    gqdfglaaaiatlifllvgalaivnlkatrmkfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3puyF (F:)
    wqsdalkwsvlgllgllvgylvvlmyaqgeylfaittlilssaglyifanrkayawryvy
    pgmagmglfvlfplvctiaiaftnysstnqltferaqevlldrswqagktynfglypagd
    ewqlalsdgetgknylsdafkfggeqklqlkettaqpegeranlrvitqnrqalsditai
    lpdgnkvmmsslrqfsgtqplytldgdgtltnnqsgvkyrpnnqigfyqsinwgdeklsp
    gytvttgwknftrvftdegiqkpflaifvwtvvfslitvfltvavgmvlaclvqwealrg
    kavyrvllilpyavpsfisilifkglfnqsfgeinmmlsalfgvkpawfsdpttartmli
    ivntwlgypymmilcmgllkaipddlyeasamdgagpfqnffkitlpllikpltplmias
    fafnfnnfvliqlltnggpdrlgtttpagytdllvnytyriafeggggqdfglaaaiatl
    ifllvgalai
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3puyG (G:)
    mamvqpksqkarlfithlllllfiaaimfpllmvvaislrqgnfatgslipeqiswdhwk
    lalgfsveqadgritpppfpvllwlwnsvkvagisaigivalsttcayafarmrfpgkat
    llkgmlifqmfpavlslvalyalfdrlgeyipfiglnthggvifaylggialhvwtikgy
    fetidssleeaaaldgatpwqafrlvllplsvpilavvfilsfiaaitevpvaslllrdv
    nsytlavgmqqylnpqnylwgdfaaaavmsalpitivfllaqrwlvngltaggvkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3puyG (G:)
    amvqpqkarlfithlllllfiaaimfpllmvvaislrqgnfatgslipeqiswdhwklal
    gfsveqadgritpppfpvllwlwnsvkvagisaigivalsttcayafarmrfpgkatllk
    gmlifqmfpavlslvalyalfdrlgeyipfiglnthggvifaylggialhvwtikgyfet
    idssleeaaaldgatpwqafrlvllplsvpilavvfilsfiaaitevpvaslllrdvnsy
    tlavgmqqylnpqnylwgdfaaaavmsalpitivfllaqrwlvngltaggvkg