![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) ![]() |
![]() | Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins) |
![]() | Protein automated matches [254700] (2 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255950] (4 PDB entries) |
![]() | Domain d3m3yi2: 3m3y I:50-120 [247595] Other proteins in same PDB: d3m3ya_, d3m3yb_, d3m3ye1, d3m3ye2, d3m3yf_, d3m3yh_, d3m3yj_, d3m3yk_, d3m3yl_ automated match to d1i50i2 protein/DNA complex; protein/RNA complex; complexed with c7p, mg, zn |
PDB Entry: 3m3y (more details), 3.18 Å
SCOPe Domain Sequences for d3m3yi2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m3yi2 g.41.3.1 (I:50-120) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi ftsdqknkrtq
Timeline for d3m3yi2: