Lineage for d3m3yi2 (3m3y I:50-120)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036360Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) (S)
  5. 3036361Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins)
  6. 3036440Protein automated matches [254700] (2 species)
    not a true protein
  7. 3036441Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255950] (4 PDB entries)
  8. 3036443Domain d3m3yi2: 3m3y I:50-120 [247595]
    Other proteins in same PDB: d3m3ya_, d3m3yb_, d3m3ye1, d3m3ye2, d3m3yf_, d3m3yh_, d3m3yj_, d3m3yk_, d3m3yl_
    automated match to d1i50i2
    protein/DNA complex; protein/RNA complex; complexed with c7p, mg, zn

Details for d3m3yi2

PDB Entry: 3m3y (more details), 3.18 Å

PDB Description: RNA polymerase II elongation complex C
PDB Compounds: (I:) DNA-directed RNA polymerase II subunit RPB9

SCOPe Domain Sequences for d3m3yi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m3yi2 g.41.3.1 (I:50-120) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtq

SCOPe Domain Coordinates for d3m3yi2:

Click to download the PDB-style file with coordinates for d3m3yi2.
(The format of our PDB-style files is described here.)

Timeline for d3m3yi2: