| Class b: All beta proteins [48724] (180 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
| Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein) duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10 automatically mapped to Pfam PF03870 |
| Protein RNA polymerase subunit RBP8 [50322] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (36 PDB entries) Uniprot P20436 |
| Domain d3m3yh_: 3m3y H: [247593] Other proteins in same PDB: d3m3ya_, d3m3yb_, d3m3ye1, d3m3ye2, d3m3yf_, d3m3yi1, d3m3yi2, d3m3yj_, d3m3yk_, d3m3yl_ automated match to d1twfh_ protein/DNA complex; protein/RNA complex; complexed with c7p, mg, zn |
PDB Entry: 3m3y (more details), 3.18 Å
SCOPe Domain Sequences for d3m3yh_:
Sequence, based on SEQRES records: (download)
>d3m3yh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl
lmrlegnyrnlnnlkqenayllirr
>d3m3yh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln
nlkqenayllirr
Timeline for d3m3yh_: