PDB entry 3m3y

View 3m3y on RCSB PDB site
Description: RNA polymerase II elongation complex C
Class: transferase/DNA-RNA hybrid
Keywords: TRANSCRIPTION, MRNA, MULTIPROTEIN COMPLEX, MOLECULAR MACHINE, DNA, DNA Damage, Cancer, Platinum Drug, DNA-binding, DNA-directed RNA polymerase, Isopeptide bond, Magnesium, Metal-binding, Nucleotidyltransferase, Nucleus, Phosphoprotein, Transferase, Ubl conjugation, Zinc, Zinc-finger, Polymorphism, Cytoplasm, DNA repair, TRANSFERASE-DNA-RNA HYBRID complex
Deposited on 2010-03-10, released 2010-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-09, with a file datestamp of 2010-06-04.
Experiment type: XRAY
Resolution: 3.18 Å
R-factor: 0.209
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase II subunit RPB1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m3ya_
  • Chain 'B':
    Compound: DNA-directed RNA polymerase II subunit RPB2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m3yb_
  • Chain 'C':
    Compound: DNA-directed RNA polymerase II subunit RPB3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: DNA-directed RNA polymerases I, II, and III subunit RPABC1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m3ye1, d3m3ye2
  • Chain 'F':
    Compound: DNA-directed RNA polymerases I, II, and III subunit RPABC2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m3yf_
  • Chain 'H':
    Compound: DNA-directed RNA polymerases I, II, and III subunit RPABC3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m3yh_
  • Chain 'I':
    Compound: DNA-directed RNA polymerase II subunit RPB9
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m3yi1, d3m3yi2
  • Chain 'J':
    Compound: DNA-directed RNA polymerases I, II, and III subunit RPABC5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m3yj_
  • Chain 'K':
    Compound: DNA-directed RNA polymerase II subunit RPB11
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m3yk_
  • Chain 'L':
    Compound: DNA-directed RNA polymerases I, II, and III subunit RPABC4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m3yl_
  • Chain 'N':
    Compound: DNA (5'-d(*gp*tp*gp*gp*tp*tp*ap*tp*gp*gp*gp*tp*ap*g)-3')
  • Chain 'R':
    Compound: RNA (5'-r(*ap*up*gp*gp*ap*gp*ap*gp*gp*ap*c)-3')
  • Chain 'T':
    Compound: DNA (28-mer)
  • Heterogens: ZN, C7P, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m3yA (A:)
    mvgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgs
    idrnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehne
    lmrqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglk
    lvgswkkdratgdadepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclp
    vppppvrpsisfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhv
    atymdndiagqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnle
    ldqvgvpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskr
    agdiqlqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspyna
    dfdgdemnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtf
    ieldqvlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllsp
    kdngmliidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhn
    gfstgigdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvr
    flneardkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfv
    drtlphfskddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrr
    lvkaledimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvd
    llntdhtldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvni
    rriiqnaqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfcc
    llrsrlatrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmt
    lntfhfagvaskkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaieh
    ttlksvtiaseiyydpdprstvipedeeiiqlhfslldeeaeqsfdqqspwllrleldra
    amndkdltmgqvgerikqtfkndlfviwsedndekliircrvvrpksldaeteaeedhml
    kkientmlenitlrgveniervvmmkydrkvpsptgeyvkepewvletdgvnlsevmtvp
    gidptriytnsfidimevlgieagraalykevynviasdgsyvnyrhmallvdvmttqgg
    ltsvtrhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsenvilgqmapigtga
    fdvmideeslvkympeqkiteiedgqdggvtpysnesglvnadldvkdelmfsplvdsgs
    ndamaggftayggadygeatspfgaygeaptspgfgvsspgfsptsptysptspayspts
    psysptspsysptspsysptspsysptspsysptspsysptspsysptspsysptspsys
    ptspsysptspsysptspsysptspsysptspsysptspaysptspsysptspsysptsp
    sysptspsysptspnysptspsysptspgyspgspayspkqdeqkhnenensr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m3yA (A:)
    gqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsid
    rnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnelm
    rqalaikdskkrfaaiwtlcktkmvcetdvpslvsrggcgntqptirkdglklvgswklr
    vlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvppppvrpsisfnesqrged
    dltfkladilkanisletlehngaphhaieeaesllqfhvatymdndiagqpqalqksgr
    pvksirarlkgkegrirgnlmgkrvdfsartvisgdpnleldqvgvpksiaktltypevv
    tpynidrltqlvrngpnehpgakyvirdsgdridlryskragdiqlqygwkverhimdnd
    pvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynadfdgdemnlhvpqseetrae
    lsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfieldqvlnmlywvpdwdgvi
    ptpaiikpkplwsgkqilsvaipngihlqrfdegttllspkdngmliidgqiifgvvekk
    tvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhngfstgigdtiadgptmreit
    etiaeakkkvldvtkeaqanlltakhgmtlresfednvvrflneardkagrlaevnlkdl
    nnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvdrtlphfskddyspeskgfv
    ensylrgltpqefffhamggreglidtavktaetgyiqrrlvkaledimvhydnttrnsl
    gnviqfiygedgmdaahiekqsldtiggsdaafekryrvdllntdhtldpsllesgseil
    gdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnirriiqnaqqtfhidhtkpsd
    ltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccllrsrlatrrvlqeyrltkq
    afdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtlkkvtsgvprlkeilnvakn
    mktpsltvylepghaadqeqaklirsaiehttlksvtiaseiyydpdprstvipedeeii
    qlhfslqqspwllrleldraamndkdltmgqvgerikqtfkndlfviwsedndekliirc
    rvvaeedhmlkkientmlenitlrgveniervvmmkydrkvpsptgeyvkepewvletdg
    vnlsevmtvpgidptriytnsfidimevlgieagraalykevynviasdgsyvnyrhmal
    lvdvmttqggltsvtrhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsenvil
    gqmapigtgafdvmi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3m3yB (B:)
    msdlansekyydedpygfedesapitaedswavisaffrekglvsqqldsfnqfvdytlq
    diicedstlileqlaqhttesdnisrkyeisfgkiyvtkpmvnesdgvthalypqearlr
    nltyssglfvdvkkrtyeaidvpgrelkyeliaeeseddsesgkvfigrlpimlrskncy
    lseatesdlyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvaei
    rsalekgsrfistlqvklygregssartikatlpyikqdipiviifralgiipdgeileh
    icydvndwqmlemlkpcvedgfviqdretaldfigrrgtalgikkekriqyakdilqkef
    lphitqlegfesrkafflgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktl
    fkkltkdifrymqrtveeahdfnmklainaktitsglkyalatgnwgeqkkamssragvs
    qvlnrytysstlshlrrtntpigrdgklakprqlhnthwglvcpaetpegqacglvknls
    lmscisvgtdpmpiitflsewgmepledyvphqspdatrvfvngvwhgvhrnparlmetl
    rtlrrkgdinpevsmirdirekelkiftdagrvyrplfiveddeslghkelkvrkghiak
    lmateyqdieggfedveeytwssllneglveyidaeeeesiliamqpedlepaeaneend
    ldvdpakrirvshhattfthceihpsmilgvaasiipfpdhnqsprntyqsamgkqamgv
    fltnynvrmdtmanilyypqkplgttrameylkfrelpagqnaivaiacysgynqedsmi
    mnqssidrglfrslffrsymdqekkygmsitetfekpqrtntlrmkhgtydkldddglia
    pgvrvsgedviigkttpispdeeelgqrtayhskrdastplrstengivdqvlvttnqdg
    lkfvkvrvrttkipqigdkfasrhgqkgtigityrredmpftaegivpdliinphaipsr
    mtvahliecllskvaalsgnegdaspftditvegiskllrehgyqsrgfevmynghtgkk
    lmaqiffgptyyqrlrhmvddkiharargpmqvltrqpvegrsrdgglrfgemerdcmia
    hgaasflkerlmeasdafrvhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaa
    kllfqelmamnitprlytdrsrdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m3yB (B:)
    desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstliisfgkiyvt
    kpmvnesdgvthalypqearlrnltyssglfvdvkkkvfigrlpimlrskncylseates
    dlyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekg
    srfistlqvklygregssartikatlpyikqdipiviifralgiipdgeilehicydvnd
    wqmlemlkpcvedgfviqdretaldfigkekriqyakdilqkeflphitqlegfesrkaf
    flgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifrymqrtv
    elainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlrrtntpiak
    prqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitflsewgmepledyv
    phqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdirekelkiftda
    grvyrplfiveddeslghkelkvrkghiaklmateyqdeytwssllneglveyidaeeee
    siliamqpedlepaeadvdpakrirvshhattfthceihpsmilgvaasiipfpdhnqsp
    rntyqsamgkqamgvfltnynvrmdtmanilyypqkplgttrameylkfrelpagqnaiv
    aiacysgynqedsmimnqssidrglfrslffrsymdqekkygmsitetfekpqrtntlrm
    khgtydkldddgliapgvrvsgedviigkttpisskrdastplrstengivdqvlvttnq
    dglkfvkvrvrttkipqigdkfasrhgqkgtigityrredmpftaegivpdliinphaip
    srmtvahliecllskvaalsgnegdaspftditvegiskllrehgyqsrgfevmynghtg
    kklmaqiffgptyyqrlrhmvddkiharargpmqvltrqpvegrsrdgglrfgemerdcm
    iahgaasflkerlmeasdafrvhicgicglmtviaklnhnqfeckgcdnkidiyqihipy
    aakllfqelmamnitprlytdrsrdf
    

  • Chain 'C':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3m3yE (E:)
    mdqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsf
    qanpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsa
    mklvpsippatietfneaalvvnithhelvpkhirlssdekrellkryrlkesqlpriqr
    adpvalylglkrgevvkiirksetsgryasyricm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m3yE (E:)
    dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq
    anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam
    klvpsippatietfneaalvvnithhelvpkhirlssdekrellkryrlkesqlpriqra
    dpvalylglkrgevvkiirksetsgryasyricm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3m3yF (F:)
    msdyeeafndgnenfedfdvehfsdeetyeekpqfkdgettdangktivtggngpedfqq
    heqirrktlkekaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplri
    amkelaekkiplvirrylpdgsfedwsveelivdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m3yF (F:)
    kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
    lvirrylpdgsfedwsveelivdl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3m3yH (H:)
    msntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtia
    sslnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfgg
    llmrlegnyrnlnnlkqenayllirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m3yH (H:)
    sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
    sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln
    nlkqenayllirr
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3m3yI (I:)
    mttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrhelitnigetagvvq
    digsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshiftsdqknkrtq
    fs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m3yI (I:)
    ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrhelitnigetagvvqd
    igsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshiftsdqknkrtq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3m3yJ (J:)
    mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
    lrynplekrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m3yJ (J:)
    mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
    lrynp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3m3yK (K:)
    mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
    ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtlaaddaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m3yK (K:)
    mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
    ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3m3yL (L:)
    msregfqiptnldaaaagtsqartatlkyicaecssklslsrtdavrckdcghrillkar
    tkrlvqfear
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m3yL (L:)
    atlkyicaecssklslsrtdavrckdcghrillkartkrlvqfear
    

  • Chain 'N':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'T':
    No sequence available.