SCOPe 2.08: Domain d3m3yi1: 3m3y I:2-49

Lineage for d3m3yi1 (3m3y I:2-49)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families)

5. Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins)

6. Protein automated matches [254700] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255950] (4 PDB entries)

8. Domain d3m3yi1: 3m3y I:2-49 [247594]
   Other proteins in same PDB: d3m3ya_, d3m3yb_, d3m3ye1, d3m3ye2, d3m3yf_, d3m3yh_, d3m3yj_, d3m3yk_, d3m3yl_
   automated match to d1twfi1
   protein/DNA complex; protein/RNA complex; complexed with c7p, mg, zn

Details for d3m3yi1

PDB Entry: 3m3y, 3.18 Å

PDB Description: RNA polymerase II elongation complex C

PDB Compounds: (I:) DNA-directed RNA polymerase II subunit RPB9

SCOPe Domain Sequences for d3m3yi1:

Sequence; same for both SEQRES and ATOM records:

>d3m3yi1 g.41.3.1 (I:2-49) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

Timeline for d3m3yi1:

• d3m3yi1 first appeared in SCOPe 2.04
  
• d3m3yi1 appears in SCOPe 2.07