![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) ![]() automatically mapped to Pfam PF02939 |
![]() | Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins) |
![]() | Protein automated matches [191133] (1 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [189229] (8 PDB entries) |
![]() | Domain d3l72g_: 3l72 G: [247373] Other proteins in same PDB: d3l72a1, d3l72a2, d3l72b1, d3l72b2, d3l72c1, d3l72c2, d3l72d1, d3l72d2, d3l72e1, d3l72e2, d3l72f_, d3l72h_, d3l72j_, d3l72n1, d3l72n2, d3l72o1, d3l72o2, d3l72p1, d3l72p2, d3l72q1, d3l72q2, d3l72r1, d3l72r2, d3l72s_, d3l72u_, d3l72w_ automated match to d3l75g_ complexed with bog, cdl, fes, gol, hec, hem, ikr, pee, uq |
PDB Entry: 3l72 (more details), 3.06 Å
SCOPe Domain Sequences for d3l72g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l72g_ f.23.13.1 (G:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} ihfgnlarvrhiityslspfeqraipnifsdalpnvwrrfssqvfkvappflgayllysw gtqeferlkrknpadyendq
Timeline for d3l72g_:
![]() Domains from other chains: (mouse over for more information) d3l72a1, d3l72a2, d3l72b1, d3l72b2, d3l72c1, d3l72c2, d3l72d1, d3l72d2, d3l72e1, d3l72e2, d3l72f_, d3l72h_, d3l72j_, d3l72n1, d3l72n2, d3l72o1, d3l72o2, d3l72p1, d3l72p2, d3l72q1, d3l72q2, d3l72r1, d3l72r2, d3l72s_, d3l72t_, d3l72u_, d3l72w_ |