Lineage for d3l72e2 (3l72 E:70-196)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782335Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 2782420Protein automated matches [190874] (7 species)
    not a true protein
  7. 2782425Species Chicken (Gallus gallus) [TaxId:9031] [260680] (8 PDB entries)
  8. 2782436Domain d3l72e2: 3l72 E:70-196 [262298]
    Other proteins in same PDB: d3l72a1, d3l72a2, d3l72b1, d3l72b2, d3l72c1, d3l72c2, d3l72d1, d3l72d2, d3l72e1, d3l72f_, d3l72g_, d3l72h_, d3l72j_, d3l72n1, d3l72n2, d3l72o1, d3l72o2, d3l72p1, d3l72p2, d3l72q1, d3l72q2, d3l72r1, d3l72s_, d3l72t_, d3l72u_, d3l72w_
    automated match to d3l70e2
    complexed with bog, cdl, fes, gol, hec, hem, ikr, pee, uq

Details for d3l72e2

PDB Entry: 3l72 (more details), 3.06 Å

PDB Description: chicken cytochrome bc1 complex with kresoxim-i-dimethyl bound
PDB Compounds: (E:) cytochrome b-c1 complex subunit 5, rieske ironsulfur protein, mitochondrial

SCOPe Domain Sequences for d3l72e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l72e2 b.33.1.1 (E:70-196) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
alskieiklsdipegknvafkwrgkplfvrhrtqaeinqeaevdvsklrdpqhdldrvkk
pewvilvgvcthlgcvpiansgdfggyycpchgshydasgrirkgpapynlevptyqfvg
ddlvvvg

SCOPe Domain Coordinates for d3l72e2:

Click to download the PDB-style file with coordinates for d3l72e2.
(The format of our PDB-style files is described here.)

Timeline for d3l72e2: