Lineage for d3l72e1 (3l72 E:1-69)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2578776Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 2578827Family f.23.12.0: automated matches [254198] (1 protein)
    not a true family
  6. 2578828Protein automated matches [254432] (4 species)
    not a true protein
  7. 2578831Species Chicken (Gallus gallus) [TaxId:9031] [260678] (8 PDB entries)
  8. 2578846Domain d3l72e1: 3l72 E:1-69 [262297]
    Other proteins in same PDB: d3l72a1, d3l72a2, d3l72b1, d3l72b2, d3l72c1, d3l72c2, d3l72d1, d3l72d2, d3l72e2, d3l72f_, d3l72g_, d3l72h_, d3l72j_, d3l72n1, d3l72n2, d3l72o1, d3l72o2, d3l72p1, d3l72p2, d3l72q1, d3l72q2, d3l72r2, d3l72s_, d3l72t_, d3l72u_, d3l72w_
    automated match to d3l70e1
    complexed with bog, cdl, fes, gol, hec, hem, ikr, pee, uq

Details for d3l72e1

PDB Entry: 3l72 (more details), 3.06 Å

PDB Description: Chicken cytochrome BC1 complex with kresoxym-I-dimethyl bound
PDB Compounds: (E:) cytochrome b-c1 complex subunit 5, rieske ironsulfur protein, mitochondrial

SCOPe Domain Sequences for d3l72e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l72e1 f.23.12.0 (E:1-69) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
vhndvtvpdfsayrredvmdattssqtssedrkgfsylvtatacvatayaaknvvtqfis
slsasadvl

SCOPe Domain Coordinates for d3l72e1:

Click to download the PDB-style file with coordinates for d3l72e1.
(The format of our PDB-style files is described here.)

Timeline for d3l72e1: