Lineage for d3l72g_ (3l72 G:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631316Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
    automatically mapped to Pfam PF02939
  5. 2631317Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)
  6. 2631364Protein automated matches [191133] (1 species)
    not a true protein
  7. 2631365Species Chicken (Gallus gallus) [TaxId:9031] [189229] (8 PDB entries)
  8. 2631380Domain d3l72g_: 3l72 G: [247373]
    Other proteins in same PDB: d3l72a1, d3l72a2, d3l72b1, d3l72b2, d3l72c1, d3l72c2, d3l72d1, d3l72d2, d3l72e1, d3l72e2, d3l72f_, d3l72h_, d3l72j_, d3l72n1, d3l72n2, d3l72o1, d3l72o2, d3l72p1, d3l72p2, d3l72q1, d3l72q2, d3l72r1, d3l72r2, d3l72s_, d3l72u_, d3l72w_
    automated match to d3l75g_
    complexed with bog, cdl, fes, gol, hec, hem, ikr, pee, uq

Details for d3l72g_

PDB Entry: 3l72 (more details), 3.06 Å

PDB Description: chicken cytochrome bc1 complex with kresoxim-i-dimethyl bound
PDB Compounds: (G:) Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c

SCOPe Domain Sequences for d3l72g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l72g_ f.23.13.1 (G:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
ihfgnlarvrhiityslspfeqraipnifsdalpnvwrrfssqvfkvappflgayllysw
gtqeferlkrknpadyendq

SCOPe Domain Coordinates for d3l72g_:

Click to download the PDB-style file with coordinates for d3l72g_.
(The format of our PDB-style files is described here.)

Timeline for d3l72g_: