![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
![]() | Protein automated matches [190435] (12 species) not a true protein |
![]() | Species Castor bean (Ricinus communis) [TaxId:3988] [187330] (3 PDB entries) |
![]() | Domain d2xz0c_: 2xz0 C: [244644] Other proteins in same PDB: d2xz0d_ automated match to d2j2fa_ complexed with edo, fe, zn |
PDB Entry: 2xz0 (more details), 3 Å
SCOPe Domain Sequences for d2xz0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xz0c_ a.25.1.2 (C:) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]} fmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfd eqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtr awtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqer atfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafad mmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltgls aegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl
Timeline for d2xz0c_: