PDB entry 2xz0

View 2xz0 on RCSB PDB site
Description: the structure of the 2:1 (partially occupied) complex between stearoyl acyl carrier protein desaturase from ricinus communis (castor bean) and acyl carrier protein.
Class: oxidoreductase/lipid binding protein
Keywords: oxidoreductase-lipid binding protein complex
Deposited on 2010-11-22, released 2011-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.24434
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-[acyl-carrier-protein] desaturase, chloroplastic
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xz0a_
  • Chain 'B':
    Compound: acyl-[acyl-carrier-protein] desaturase, chloroplastic
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xz0b_
  • Chain 'C':
    Compound: acyl-[acyl-carrier-protein] desaturase, chloroplastic
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xz0c_
  • Chain 'D':
    Compound: acyl carrier protein 1, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07854 (0-81)
      • see remark 999 (9)
      • see remark 999 (75)
    Domains in SCOPe 2.07: d2xz0d_
  • Heterogens: FE, ZN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xz0A (A:)
    astlksgskevenlkkpfmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvek
    cwqpqdflpdpasdgfdeqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldg
    vrdetgasptswaiwtrawtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdpr
    tenspylgfiytsfqeratfishgntarqakehgdiklaqicgtiaadekrhetaytkiv
    eklfeidpdgtvlafadmmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadi
    leflvgrwkvdkltglsaegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrq
    vkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xz0A (A:)
    fmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfd
    eqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtr
    awtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqer
    atfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafad
    mmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltgls
    aegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xz0B (B:)
    astlksgskevenlkkpfmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvek
    cwqpqdflpdpasdgfdeqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldg
    vrdetgasptswaiwtrawtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdpr
    tenspylgfiytsfqeratfishgntarqakehgdiklaqicgtiaadekrhetaytkiv
    eklfeidpdgtvlafadmmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadi
    leflvgrwkvdkltglsaegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrq
    vkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xz0B (B:)
    fmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfd
    eqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtr
    awtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqer
    atfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafad
    mmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltgls
    aegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2xz0C (C:)
    astlksgskevenlkkpfmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvek
    cwqpqdflpdpasdgfdeqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldg
    vrdetgasptswaiwtrawtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdpr
    tenspylgfiytsfqeratfishgntarqakehgdiklaqicgtiaadekrhetaytkiv
    eklfeidpdgtvlafadmmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadi
    leflvgrwkvdkltglsaegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrq
    vkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xz0C (C:)
    fmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfd
    eqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtr
    awtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqer
    atfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafad
    mmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltgls
    aegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xz0D (D:)
    akketidkvsdivkeklalgadvvvtadsefsklgadsldtveivmnleeefginvdedk
    aqdistiqqaadviegllekka