SCOPe 2.08: Domain d2xz0a_: 2xz0 A:

Lineage for d2xz0a_ (2xz0 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein automated matches [190435] (12 species)
   not a true protein

7. Species Castor bean (Ricinus communis) [TaxId:3988] [187330] (3 PDB entries)

8. Domain d2xz0a_: 2xz0 A: [244642]
   Other proteins in same PDB: d2xz0d_
   automated match to d2j2fa_
   complexed with edo, fe, zn

Details for d2xz0a_

PDB Entry: 2xz0, 3 Å

PDB Description: the structure of the 2:1 (partially occupied) complex between stearoyl acyl carrier protein desaturase from ricinus communis (castor bean) and acyl carrier protein.

PDB Compounds: (A:) acyl-[acyl-carrier-protein] desaturase, chloroplastic

SCOPe Domain Sequences for d2xz0a_:

Sequence; same for both SEQRES and ATOM records:

>d2xz0a_ a.25.1.2 (A:) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]}
fmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfd
eqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtr
awtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqer
atfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafad
mmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltgls
aegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl

Timeline for d2xz0a_:

• d2xz0a_ first appeared in SCOPe 2.04
  
• d2xz0a_ appears in SCOPe 2.07