Lineage for d2xz0c_ (2xz0 C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1485832Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1486126Protein automated matches [190435] (9 species)
    not a true protein
  7. 1486127Species Castor bean (Ricinus communis) [TaxId:3988] [187330] (2 PDB entries)
  8. 1486136Domain d2xz0c_: 2xz0 C: [244644]
    Other proteins in same PDB: d2xz0d_
    automated match to d2j2fa_
    complexed with edo, fe, zn

Details for d2xz0c_

PDB Entry: 2xz0 (more details), 3 Å

PDB Description: the structure of the 2:1 (partially occupied) complex between stearoyl acyl carrier protein desaturase from ricinus communis (castor bean) and acyl carrier protein.
PDB Compounds: (C:) acyl-[acyl-carrier-protein] desaturase, chloroplastic

SCOPe Domain Sequences for d2xz0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xz0c_ a.25.1.2 (C:) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]}
fmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfd
eqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtr
awtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqer
atfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafad
mmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltgls
aegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl

SCOPe Domain Coordinates for d2xz0c_:

Click to download the PDB-style file with coordinates for d2xz0c_.
(The format of our PDB-style files is described here.)

Timeline for d2xz0c_: