Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
Protein automated matches [231466] (5 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [232069] (10 PDB entries) |
Domain d3nvvj1: 3nvv J:2-92 [239511] Other proteins in same PDB: d3nvva2, d3nvvb1, d3nvvb2, d3nvvc1, d3nvvc2, d3nvvj2, d3nvvk1, d3nvvk2, d3nvvl1, d3nvvl2 automated match to d3etrl1 complexed with ast, fad, fes, mos, mte |
PDB Entry: 3nvv (more details), 1.82 Å
SCOPe Domain Sequences for d3nvvj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nvvj1 d.15.4.2 (J:2-92) automated matches {Cow (Bos taurus) [TaxId: 9913]} tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl qdkiihfsanaclapictlhhvavttvegig
Timeline for d3nvvj1: