Lineage for d3nvvb1 (3nvv B:195-414)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987459Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2987460Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2987556Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 2987615Protein automated matches [232070] (2 species)
    not a true protein
  7. 2987616Species Cow (Bos taurus) [TaxId:9913] [232074] (11 PDB entries)
  8. 2987619Domain d3nvvb1: 3nvv B:195-414 [233053]
    Other proteins in same PDB: d3nvva1, d3nvva2, d3nvvb2, d3nvvc1, d3nvvc2, d3nvvj1, d3nvvj2, d3nvvk2, d3nvvl1, d3nvvl2
    automated match to d1v97a6
    complexed with ast, fad, fes, mos, mte

Details for d3nvvb1

PDB Entry: 3nvv (more details), 1.82 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Arsenite
PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nvvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nvvb1 d.145.1.3 (B:195-414) automated matches {Cow (Bos taurus) [TaxId: 9913]}
lfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqastlkelldlkaqhpe
aklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfgaacalssvektlle
avaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtklti
vsrgtrrtvpmdhtffpsyrktllgpeeillsieipysre

SCOPe Domain Coordinates for d3nvvb1:

Click to download the PDB-style file with coordinates for d3nvvb1.
(The format of our PDB-style files is described here.)

Timeline for d3nvvb1: