Lineage for d3nvva1 (3nvv A:2-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933988Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2934157Protein automated matches [231466] (5 species)
    not a true protein
  7. 2934166Species Cow (Bos taurus) [TaxId:9913] [232069] (10 PDB entries)
  8. 2934169Domain d3nvva1: 3nvv A:2-92 [239507]
    Other proteins in same PDB: d3nvva2, d3nvvb1, d3nvvb2, d3nvvc1, d3nvvc2, d3nvvj2, d3nvvk1, d3nvvk2, d3nvvl1, d3nvvl2
    automated match to d3etrl1
    complexed with ast, fad, fes, mos, mte

Details for d3nvva1

PDB Entry: 3nvv (more details), 1.82 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Arsenite
PDB Compounds: (A:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nvva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nvva1 d.15.4.2 (A:2-92) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
qdkiihfsanaclapictlhhvavttvegig

SCOPe Domain Coordinates for d3nvva1:

Click to download the PDB-style file with coordinates for d3nvva1.
(The format of our PDB-style files is described here.)

Timeline for d3nvva1: