![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
![]() | Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) ![]() |
![]() | Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins) automatically mapped to Pfam PF00941 |
![]() | Protein automated matches [232070] (2 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [232074] (11 PDB entries) |
![]() | Domain d3nvvk1: 3nvv K:224-414 [239513] Other proteins in same PDB: d3nvva1, d3nvva2, d3nvvb2, d3nvvc1, d3nvvc2, d3nvvj1, d3nvvj2, d3nvvk2, d3nvvl1, d3nvvl2 automated match to d3nvvb1 complexed with ast, fad, fes, mos, mte |
PDB Entry: 3nvv (more details), 1.82 Å
SCOPe Domain Sequences for d3nvvk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nvvk1 d.145.1.3 (K:224-414) automated matches {Cow (Bos taurus) [TaxId: 9913]} pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei llsieipysre
Timeline for d3nvvk1: