Lineage for d3nvvk2 (3nvv K:415-528)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962835Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2962998Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 2963058Family d.87.2.0: automated matches [232089] (1 protein)
    not a true family
  6. 2963059Protein automated matches [232090] (5 species)
    not a true protein
  7. 2963060Species Cow (Bos taurus) [TaxId:9913] [232091] (11 PDB entries)
  8. 2963064Domain d3nvvk2: 3nvv K:415-528 [239514]
    Other proteins in same PDB: d3nvva1, d3nvva2, d3nvvb1, d3nvvc1, d3nvvc2, d3nvvj1, d3nvvj2, d3nvvk1, d3nvvl1, d3nvvl2
    automated match to d3nvvb2
    complexed with ast, fad, fes, mos, mte

Details for d3nvvk2

PDB Entry: 3nvv (more details), 1.82 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Arsenite
PDB Compounds: (K:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nvvk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nvvk2 d.87.2.0 (K:415-528) automated matches {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg

SCOPe Domain Coordinates for d3nvvk2:

Click to download the PDB-style file with coordinates for d3nvvk2.
(The format of our PDB-style files is described here.)

Timeline for d3nvvk2: