![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
![]() | Protein automated matches [231466] (5 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [232069] (10 PDB entries) |
![]() | Domain d3etrl1: 3etr L:2-92 [232073] Other proteins in same PDB: d3etra2, d3etrb1, d3etrb2, d3etrc1, d3etrc2, d3etrl2, d3etrm1, d3etrm2, d3etrn1, d3etrn2 automated match to d1fiqa2 complexed with ca, fad, fes, luz, mos, mte |
PDB Entry: 3etr (more details), 2.2 Å
SCOPe Domain Sequences for d3etrl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3etrl1 d.15.4.2 (L:2-92) automated matches {Cow (Bos taurus) [TaxId: 9913]} tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl qdkiihfsanaclapictlhhvavttvegig
Timeline for d3etrl1: