Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (37 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:2287] [255781] (6 PDB entries) |
Domain d3cw2a1: 3cw2 A:2-206 [239188] Other proteins in same PDB: d3cw2a2, d3cw2a3, d3cw2b2, d3cw2b3, d3cw2c1, d3cw2c2, d3cw2c3, d3cw2d1, d3cw2d2, d3cw2d3, d3cw2e2, d3cw2e3, d3cw2f2, d3cw2f3, d3cw2g1, d3cw2g2, d3cw2g3, d3cw2h1, d3cw2h2, d3cw2h3 automated match to d2qn6a3 |
PDB Entry: 3cw2 (more details), 2.8 Å
SCOPe Domain Sequences for d3cw2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cw2a1 c.37.1.8 (A:2-206) automated matches {Sulfolobus solfataricus [TaxId: 2287]} awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii pvsalhkinidsliegieeyiktpy
Timeline for d3cw2a1: