SCOPe 2.08: Domain d3cw2c1: 3cw2 C:1-84

Lineage for d3cw2c1 (3cw2 C:1-84)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
   barrel, closed; n=5, S=8

6. Protein Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain [74950] (3 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [141310] (2 PDB entries)
   Uniprot Q97Z79 1-84

8. Domain d3cw2c1: 3cw2 C:1-84 [208957]
   Other proteins in same PDB: d3cw2a1, d3cw2a2, d3cw2a3, d3cw2b1, d3cw2b2, d3cw2b3, d3cw2c2, d3cw2c3, d3cw2d2, d3cw2d3, d3cw2e1, d3cw2e2, d3cw2e3, d3cw2f1, d3cw2f2, d3cw2f3, d3cw2g2, d3cw2g3, d3cw2h2, d3cw2h3
   automated match to d2ahob2

Details for d3cw2c1

PDB Entry: 3cw2, 2.8 Å

PDB Description: crystal structure of the intact archaeal translation initiation factor 2 from sulfolobus solfataricus .

PDB Compounds: (C:) Translation initiation factor 2 subunit alpha

SCOPe Domain Sequences for d3cw2c1:

Sequence; same for both SEQRES and ATOM records:

>d3cw2c1 b.40.4.5 (C:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
miysrsklpsegeiliatvkqvfdygsyvsldeygglqaflpwsevsskwvknirdvlke
nrkvivkvirvdrrkgtvdvslkk

Timeline for d3cw2c1:

• d3cw2c1 first appeared in SCOPe 2.03
  
• d3cw2c1 appears in SCOPe 2.07