SCOPe 2.08: Domain d3cw2g2: 3cw2 G:85-175

Lineage for d3cw2g2 (3cw2 G:85-175)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.14: eIF2alpha middle domain-like [116742] (2 families)

5. Family a.60.14.1: eIF2alpha middle domain-like [116743] (1 protein)

6. Protein Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 [116744] (3 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [140651] (2 PDB entries)
   Uniprot Q97Z79 85-175

8. Domain d3cw2g2: 3cw2 G:85-175 [208964]
   Other proteins in same PDB: d3cw2a1, d3cw2a2, d3cw2a3, d3cw2b1, d3cw2b2, d3cw2b3, d3cw2c1, d3cw2c3, d3cw2d1, d3cw2d3, d3cw2e1, d3cw2e2, d3cw2e3, d3cw2f1, d3cw2f2, d3cw2f3, d3cw2g1, d3cw2g3, d3cw2h1, d3cw2h3
   automated match to d2ahob1

Details for d3cw2g2

PDB Entry: 3cw2, 2.8 Å

PDB Description: crystal structure of the intact archaeal translation initiation factor 2 from sulfolobus solfataricus .

PDB Compounds: (G:) Translation initiation factor 2 subunit alpha

SCOPe Domain Sequences for d3cw2g2:

Sequence; same for both SEQRES and ATOM records:

>d3cw2g2 a.60.14.1 (G:85-175) Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 {Sulfolobus solfataricus [TaxId: 2287]}
vtdderrkknlqwkkiqrldkilelvsqklklsekdaweqvawkleakygdpitaiekav
kegekilidagvpeiwvkplleeaskhaeer

Timeline for d3cw2g2:

• d3cw2g2 first appeared in SCOPe 2.03
  
• d3cw2g2 appears in SCOPe 2.07